TA330842 SLC35E2B antibody

Rabbit Polyclonal Anti-SLC35E2B Antibody

See related secondary antibodies

Search for all "SLC35E2B"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human SLC35E2B

Product Description for SLC35E2B

Rabbit anti Canine, Human SLC35E2B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC35E2B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KIAA0447, Solute carrier family 35 member E2B
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P0CK96
Immunogen:
The immunogen for Anti-SLC35E2B antibody is: synthetic peptide directed towards the N-terminal region of Human SLC35E2B. Synthetic peptide located within the following region: SVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENV.
GeneID:
728661
Application WB
Background SLC35E2B is a putative transporter.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SLC35E2B (1 products)

Catalog No. Species Pres. Purity   Source  

SLC35E2B overexpression lysate

SLC35E2B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn