
NBP1-74197 SLC35F3 antibody

See related secondary antibodies

Search for all "SLC35F3"

50 µg / €440.00

Quick Overview

Rabbit anti Mouse SLC35F3


Product Description for SLC35F3

Rabbit anti Mouse SLC35F3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC35F3

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the C terminal of Slc35f3. Immunizing peptide sequence IGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEETAESSGDLGTGPQSRSRR.
Background Slc35f3 is a putative solute transporter Potential.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified
Gene ID 210027

Accessory Products

  • LinkedIn