
NBP1-69235 SLC38A9 antibody

See related secondary antibodies

Search for all "SLC38A9"

50 µg / €440.00

Quick Overview

Rabbit anti Human SLC38A9

Product Description for SLC38A9

Rabbit anti Human SLC38A9.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC38A9

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to FLJ90709 The peptide sequence was selected from the middle region of FLJ90709. Peptide sequence VLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNS.
Background The exact function of FLJ90709 remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn