NBP1-69235 SLC38A9 antibody

See related secondary antibodies

Search for all "SLC38A9"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLC38A9

Product Description for SLC38A9

Rabbit anti Human SLC38A9.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC38A9

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to FLJ90709 The peptide sequence was selected from the middle region of FLJ90709. Peptide sequence VLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNS.
Background The exact function of FLJ90709 remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn