TA334120 SLC39A7 antibody

Rabbit Polyclonal Anti-SLC39A7 Antibody

See related secondary antibodies

Search for all "SLC39A7"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Sheep SLC39A7

Product Description for SLC39A7

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Sheep SLC39A7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC39A7

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms HKE4, Histidine-rich membrane protein Ke4, RING5, Really interesting new gene 5 protein, Solute carrier family 39 member 7, Zinc transporter SLC39A7
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-SLC39A7 Antibody: synthetic peptide directed towards the N terminal of human SLC39A7. Synthetic peptide located within the following region: HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP.
Application WB
Background Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.[supplied by OMIM].
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC39A7 (6 products)

Catalog No. Species Pres. Purity   Source  

SLC39A7 (transcript variant 2)

SLC39A7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


SLC39A7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


SLC39A7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


SLC39A7 Human Purified
  Abnova Taiwan Corp.


SLC39A7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


SLC39A7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SLC39A7 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC39A7 Lysate

Western Blot: SLC39A7 Lysate [NBL1-16150] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SLC39A7
  Novus Biologicals Inc.
  • LinkedIn