discontinued

NBP1-59786 SLC45A2 antibody

See related secondary antibodies

Search for all "SLC45A2"

Quick Overview

Rabbit anti Human SLC45A2

Product Description for SLC45A2

Rabbit anti Human SLC45A2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC45A2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms AIM1
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P2P0
Immunogen:
Synthetic peptides corresponding to SLC45A2(solute carrier family 45, member 2) The peptide sequence was selected from the C terminal of SLC45A2. Peptide sequence IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC.
GeneID:
51151
Background SLC45A2 is a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4.The protein encoded by this gene encodes a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4. Alternative splicing results in multiple transcript variants encoding different isoforms.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 51151

Accessory Products

  • LinkedIn