NBP1-74199 SLC9A10 antibody

See related secondary antibodies

Search for all "SLC9A10"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Rat SLC9A10

NBP1-74199

Product Description for SLC9A10

Rabbit anti Rat SLC9A10.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC9A10

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6FAG5
Immunogen:
Synthetic peptides corresponding to the middle region of Slc9a10. Immunizing peptide sequence IQEKAKVVTFDCGNNIFEEGDEPEGIYVIISGMVKLKRSKPHLEMDRVSS.
GeneID:
2881170
Background The function of this protein remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Reconstitute with 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 2881170

Accessory Products

  • LinkedIn