discontinued

NBP1-74062 SLC9A5 antibody

See related secondary antibodies

Search for all "SLC9A5"

50 µg / €390.00

Quick Overview

Rabbit anti Mouse SLC9A5

NBP1-74062

Product Description for SLC9A5

Rabbit anti Mouse SLC9A5.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC9A5

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B2RXE2
Immunogen:
Synthetic peptides corresponding to the C terminal of Slc9a5. Immunizing peptide sequence SFAFPPSLAKAGRSRSESSADIPQQELQPLMGHKDHTHLSPGTANSHWCI.
GeneID:
277973
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
State:
Aff - Purified
Gene ID 277973

Accessory Products

  • LinkedIn