TA333608 SLC9A7 / NHE7 antibody

Rabbit Polyclonal Anti-SLC9A7 Antibody

See related secondary antibodies

Search for all "SLC9A7 / NHE7"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLC9A7 / NHE7

Product Description for SLC9A7 / NHE7

Rabbit anti Human SLC9A7 / NHE7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC9A7 / NHE7

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms NHE-7, Na(+)/H(+) exchanger 7, Sodium/hydrogen exchanger 7, Solute carrier family 9 member 7
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-SLC9A7 Antibody: synthetic peptide directed towards the N terminal of human SLC9A7. Synthetic peptide located within the following region: LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI.
Application WB
Background Organelles of the secretory and endocytic pathways are distinguished by their lumil acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of interlized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. It may play an important role in maintaining cation homeostasis and function of the trans-Golgi network.Organelles of the secretory and endocytic pathways are distinguished by their lumil acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of interlized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predomintly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.Organelles of the secretory and endocytic pathways are distinguished by their lumil acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of interlized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predomintly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn