NBP1-91060 SLFN12L antibody

See related secondary antibodies

Search for all "SLFN12L"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SLFN12L

Product Description for SLFN12L

Rabbit anti Human SLFN12L.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for SLFN12L

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6IEE8
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NRVKQLTEKEWIQFMVDSEPVCEELPSPASTSSPVSQSYPLREYINFKIQPLRYHLPGLSEKITCAPKTFCRNLFSQHEGLK
GeneID:
100506736
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 100506736

Accessory Products

Proteins and/or Positive Controls

Positive controls for SLFN12L (1 products)

Catalog No. Species Pres. Purity   Source  

SLFN12L overexpression lysate

SLFN12L overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn