discontinued

H00010571-A01 SMA3 antibody

See related secondary antibodies

Search for all "SMA3"

50 µl / €290.00

Quick Overview

Mouse anti Human SMA3

H00010571-A01

Product Description for SMA3

Mouse anti Human SMA3.
Presentation: Serum
Product is tested for Western blot / Immunoblot.

Properties for SMA3

Product Category Primary Antibodies
Quantity 50 µl
Presentation Serum
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
SMA3 (NP_006771, 49 a.a. ~ 141 a.a) partial recombinant protein with GST tag.
AA Sequence:
AGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLWDQLHLRSRQGGSVCGCDPCEQLLLLVS QLRAPGVDSAAAGRPV*
Remarks:
Gene Accession: NM_006780
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
50 % glycerol
State:
Serum

Accessory Products

  • LinkedIn