discontinued

H00010571-B01 SMA3 MaxPab mouse antibody

See related secondary antibodies

Search for all "SMA3 MaxPab mouse"

50 µl / €370.00

Quick Overview

Mouse anti Human SMA3 MaxPab mouse

H00010571-B01

Product Description for SMA3 MaxPab mouse

Mouse anti Human SMA3 MaxPab mouse.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for SMA3 MaxPab mouse

Product Category Primary Antibodies
Quantity 50 µl
Synonyms SMA3, b55C20.2
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
SMA3 (-, 1 a.a. ~ 140 a.a) full-length human protein.
AA Sequence:
MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLY SWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV
Remarks:
Gene Accession: BC002622
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
None
State:
Purified

Accessory Products

  • LinkedIn