H00011039-A01 SMA3 / SMA4 antibody

See related secondary antibodies

Search for all "SMA3 / SMA4"

50 µl / €290.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human SMA3 / SMA4

H00011039-A01

Product Description for SMA3 / SMA4

Mouse anti Human SMA3 / SMA4.
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for SMA3 / SMA4

Product Category Primary Antibodies
Quantity 50 µl
Synonyms FLJ36702, FLJ39772, MGC22265, MGC60382, b55C20.2, glucuronidase beta pseudogene
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
SMA4 (NP_006771, 49 a.a. ~ 141 a.a) partial recombinant protein with GST tag.
AA Sequence:
AGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLWDQLHLRSRQGGSVCGCDPCEQLLLLVS QLRAPGVDSAAAGRPV*
Remarks:
Gene Accession: NM_006780
Add. information Mouse polyclonal antibody raised against a partial recombinant SMA4.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
50 % glycerol
Purity:
Antibody Reactive Against Recombinant Protein.
Specificity
Species:
Human

Accessory Products

  • LinkedIn