H00011039-B01 SMA3 / SMA4 MaxPab mouse antibody

See related secondary antibodies

Search for all "SMA3 / SMA4 MaxPab mouse"

50 µl / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human SMA3 / SMA4 MaxPab mouse

H00011039-B01

More Views

  • H00011039-B01

Product Description for SMA3 / SMA4 MaxPab mouse

Mouse anti Human SMA3 / SMA4 MaxPab mouse.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for SMA3 / SMA4 MaxPab mouse

Product Category Primary Antibodies
Quantity 50 µl
Synonyms FLJ36702, FLJ39772, MGC22265, MGC60382, b55C20.2, glucuronidase beta pseudogene
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
SMA4 (NP_067684.2, 1 a.a. ~ 140 a.a) full-length human protein.
AA Sequence:
MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLY SWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV
Remarks:
Gene Accession: BC050737.1
Add. information Mouse polyclonal antibody raised against a full-length human SMA4 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn