discontinued

H00003070-M04 SMARCA6 / HELLS antibody

See related secondary antibodies

Search for all "SMARCA6 / HELLS"

Quick Overview

Mouse anti Human SMARCA6 / HELLS 2G10

Product Description for SMARCA6 / HELLS

Mouse anti Human SMARCA6 / HELLS 2G10.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for SMARCA6 / HELLS

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Lymphoid-specific helicase, PASG, Proliferation-associated SNF2-like protein, SWI/SNF2-related matrix-associated actin-dependent regulator of chromatin subfamily A member 6
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2G10
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NRZ9
Immunogen:
HELLS (AAH30963, 1 a.a. ~ 349 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPVESEVNLKLQNIMML LRKCCNHPYLIEYPIDPVTQEFKIDEELVTNSGKFLILDRMLPELKKRGHKVLLFSQMTSMLDILMDYCHLRDFNF SRLDGSMSYSEREKNMHSFNTDPEVFIFLVSTRAGGLGINLTAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPVV VYRLVTANTIDQKIVERAAAKRKLEKL
GeneID:
3070
Remarks:
Gene Accession: BC030963
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant HELLS.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3070

Accessory Products

Proteins and/or Positive Controls

Proteins for SMARCA6 / HELLS (3 products)

Catalog No. Species Pres. Purity   Source  

SMARCA6 / HELLS

SMARCA6 / HELLS Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

SMARCA6 / HELLS

SMARCA6 / HELLS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SMARCA6 / HELLS

SMARCA6 / HELLS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SMARCA6 / HELLS (3 products)

Catalog No. Species Pres. Purity   Source  

HELLS 293T Cell Transient Overexpression Lysate(Denatured)

HELLS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HELLS overexpression lysate

HELLS overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

SMARCA6 Lysate

Western Blot: SMARCA6 Lysate [NBL1-11502] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HELLS
  Novus Biologicals Inc.
  • LinkedIn