
NBP1-53165 SMPX antibody

See related secondary antibodies

Search for all "SMPX"

0.1 mg / €360.00

Quick Overview

Rabbit anti Canine, Human SMPX

Product Description for SMPX

Rabbit anti Canine, Human SMPX.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SMPX

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SMPX(small muscle protein, X-linked) The peptide sequence was selected from the middle region of SMPX. Peptide sequence TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ.
Background SMPX plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 23676

Accessory Products

  • LinkedIn