TA341836 SMYD1 antibody

Rabbit Polyclonal Anti-SMYD1 Antibody

See related secondary antibodies

Search for all "SMYD1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SMYD1

Product Description for SMYD1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SMYD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SMYD1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms SET and MYND domain-containing protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-SMYD1 antibody: synthetic peptide directed towards the N terminal of mouse SMYD1. Synthetic peptide located within the following region: MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTC.
Application WB
Background SMYD1 is a histone methyltransferases and plays a critical role in myofibril organization during myofiber maturation
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for SMYD1 (1 products)

Catalog No. Species Pres. Purity   Source  


SMYD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn