discontinued

NBP1-91104 SNN antibody

See related secondary antibodies

Search for all "SNN"

Quick Overview

Rabbit anti Human SNN

Product Description for SNN

Rabbit anti Human SNN.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for SNN

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75324
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEV
GeneID:
8303
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 8303

Accessory Products

Proteins and/or Positive Controls

Positive controls for SNN (1 products)

Catalog No. Species Pres. Purity   Source  

SNN overexpression lysate

SNN overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn