NBP1-91104 SNN antibody

See related secondary antibodies

Search for all "SNN"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SNN

Product Description for SNN

Rabbit anti Human SNN.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for SNN

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75324
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEV
GeneID:
8303
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 8303

Accessory Products

Proteins and/or Positive Controls

Positive controls for SNN (1 products)

Catalog No. Species Pres. Purity   Source  

SNN overexpression lysate

SNN overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn