NBP1-57215 SNRPB antibody

See related secondary antibodies

Search for all "SNRPB"

Quick Overview

Rabbit anti Human, Mouse, Rat SNRPB

Product Description for SNRPB

Rabbit anti Human, Mouse, Rat SNRPB.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SNRPB

Product Category Primary Antibodies
Quantity 50 µg
Synonyms COD, SNRPB1, SmB/SmB\', snRNP-B
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SNRPB(small nuclear ribonucleoprotein polypeptides B and B1) The peptide sequence was selected from the N terminal of SNRPB. Peptide sequence DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG.
Background SNRPB is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 6628

Accessory Products

  • LinkedIn