NBP1-57215 SNRPB antibody

See related secondary antibodies

Search for all "SNRPB"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat SNRPB

Product Description for SNRPB

Rabbit anti Human, Mouse, Rat SNRPB.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SNRPB

Product Category Primary Antibodies
Quantity 50 µg
Synonyms COD, SNRPB1, SmB/SmB\', snRNP-B
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q66K91
Immunogen:
Synthetic peptides corresponding to SNRPB(small nuclear ribonucleoprotein polypeptides B and B1) The peptide sequence was selected from the N terminal of SNRPB. Peptide sequence DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG.
GeneID:
6628
Background SNRPB is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 6628

Accessory Products

  • LinkedIn