NBP1-70708 SNRPD2P2 antibody

See related secondary antibodies

Search for all "SNRPD2P2"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SNRPD2P2

Product Description for SNRPD2P2

Rabbit anti Human SNRPD2P2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SNRPD2P2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4G1D0
Immunogen:
Synthetic peptides corresponding to LOC645339 (hypothetical LOC645339) The peptide sequence was selected from the middle region of LOC645339. Peptide sequence MVLENVKEMCTEVPKGGNGGKGKKKSKPANKDHFISKLFLCRDSVITNKW.
GeneID:
645339
Background The function of this protein remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 645339

Accessory Products

  • LinkedIn