discontinued

NBP1-90948 SNX29 antibody

See related secondary antibodies

Search for all "SNX29"

0.1 ml / €360.00

Quick Overview

Rabbit anti Human SNX29

NBP1-90948

More Views

  • NBP1-90948

Product Description for SNX29

Rabbit anti Human SNX29.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SNX29

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TEQ0
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MMDQPQPSLTRADESPCDRVLSPCAAHRKQRDCCVSWKAEPERFLVK
GeneID:
92017
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 92017

Accessory Products

  • LinkedIn