
NBP1-59813 Sodium Potassium ATPase Beta 1 antibody

See related secondary antibodies

Search for all "Sodium Potassium ATPase Beta 1"

50 µg / €390.00

Quick Overview

Rabbit anti Human Sodium Potassium ATPase Beta 1

Product Description for Sodium Potassium ATPase Beta 1

Rabbit anti Human Sodium Potassium ATPase Beta 1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Sodium Potassium ATPase Beta 1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ATP1B, MGC1798
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ATP1B1(ATPase, Na+/K+ transporting, beta 1 polypeptide) The peptide sequence was selected from the N terminal of ATP1B1. Peptide sequence RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD.
Background ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K io
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn