
NBP1-74096 SOX5 antibody

See related secondary antibodies

Search for all "SOX5"

Quick Overview

Rabbit anti Bovine, Chicken, Human, Mouse, Rat SOX5

Product Description for SOX5

Rabbit anti Bovine, Chicken, Human, Mouse, Rat SOX5.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SOX5

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Bov, Chk, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the C terminal of SOX5. Immunizing peptide sequence PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG.
Background SOX5 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified

Accessory Products

  • LinkedIn