
NBP1-74096 SOX5 antibody

See related secondary antibodies

Search for all "SOX5"

50 µg / €440.00

Quick Overview

Rabbit anti Bovine, Chicken, Human, Mouse, Rat SOX5

Product Description for SOX5

Rabbit anti Bovine, Chicken, Human, Mouse, Rat SOX5.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SOX5

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Bov, Chk, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the C terminal of SOX5. Immunizing peptide sequence PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG.
Background SOX5 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified

Accessory Products

  • LinkedIn