NBP1-58028 SP1 antibody

See related secondary antibodies

Search for all "SP1"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SP1

Product Description for SP1

Rabbit anti Human SP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SP1

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms B1G1, CD66f, DHFRP2, FLJ90598, FLJ90654, PBG1, PSBG1, PSGGA, SP1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PSG1(pregnancy specific beta-1-glycoprotein 1) The peptide sequence was selected from the C terminal of PSG1. Peptide sequence YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA.
Background The function remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 5669

Accessory Products

  • LinkedIn