discontinued

H00064649-M04A SPANXB1 antibody

See related secondary antibodies

Search for all "SPANXB1"

0.2 ml / €370.00

Quick Overview

Mouse anti Human SPANXB1 2E12

H00064649-M04A

Product Description for SPANXB1

Mouse anti Human SPANXB1 2E12.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for SPANXB1

Product Category Primary Antibodies
Quantity 0.2 ml
Synonyms SPANX, SPANX family, SPANX-B, SPANXB, SPANXB2, member B1
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2E12
Host Mouse
Isotype IgM
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
SPANXB1 (-, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag.
AA Sequence:
MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELVND HARENRINPDQMEEEEFIEITTERPKK*
Remarks:
Gene Accession: BC034472
Isotype control SM13P
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In ascites fluid
State:
Purified

Accessory Products

  • LinkedIn