NBP1-94095 SPANXN4 antibody

See related secondary antibodies

Search for all "SPANXN4"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SPANXN4

Product Description for SPANXN4

Rabbit anti Human SPANXN4.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for SPANXN4

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5MJ08
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KEKGDLDISAGSPQDGEEEKDLVFLGARACLEEHIRRSVLYVGDSDTLSKMKTSESPPSGHIPQSGVFCNSPNAV
GeneID:
441525
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 441525

Accessory Products

Proteins and/or Positive Controls

Proteins for SPANXN4 (1 products)

Catalog No. Species Pres. Purity   Source  

SPANX family, member N4 (SPANXN4)

SPANX family, member N4 (SPANXN4) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for SPANXN4 (1 products)

Catalog No. Species Pres. Purity   Source  

SPANXN4 overexpression lysate

SPANXN4 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn