TA343173 Spectrin beta II / SPTBN1 antibody

Rabbit Polyclonal Anti-SPTBN1 Antibody

See related secondary antibodies

Search for all "Spectrin beta II / SPTBN1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Spectrin beta II / SPTBN1

Product Description for Spectrin beta II / SPTBN1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Spectrin beta II / SPTBN1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Spectrin beta II / SPTBN1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Beta-II spectrin, Fodrin beta chain, SPTB2, Spectrin beta chain brain 1, Spectrin non-erythroid beta chain 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q01082
Immunogen:
The immunogen for anti-SPTBN1 antibody is: synthetic peptide directed towards the C-terminal region of Human SPTBN1. Synthetic peptide located within the following region: DKHEVSASTQSTPASSRAQTLPTSVVTITSESSPGKREKDKEKDKEKRFS.
GeneID:
6711
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 933% sucrose.
State:
Purified

Accessory Products

  • LinkedIn