H00025876-B01P SPEF1 antibody

See related secondary antibodies

Search for all "SPEF1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human SPEF1

H00025876-B01P

Product Description for SPEF1

Mouse anti Human SPEF1.
Product is tested for Western blot / Immunoblot.

Properties for SPEF1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C20orf28, CLAMP, DKFZp434I114, SPEF1A
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y4P9
Immunogen:
SPEF1 (AAH22476.1, 1 a.a. ~ 162 a.a) full-length human protein.
AA Sequence:
MASSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKV LKRLNFSVPDDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQGAGSLQELAPQDGSGYMDVGKVAFSISPSRLE LSFCPSSCHL
GeneID:
25876
Add. information Mouse polyclonal antibody raised against a full-length human SPEF1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for SPEF1 (1 products)

Catalog No. Species Pres. Purity   Source  

SPEF1 overexpression lysate

SPEF1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn