NBP1-93701 SPINK13 antibody

See related secondary antibodies

Search for all "SPINK13"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SPINK13

Product Description for SPINK13

Rabbit anti Human SPINK13.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for SPINK13

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q1W4C9
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FNKRDFTRWPKPRCKMYIPLDPDYNADCPNVTAPVCASNGHTFQNECFFCVEQREFHYRI
GeneID:
153218
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 153218

Accessory Products

Proteins and/or Positive Controls

Positive controls for SPINK13 (1 products)

Catalog No. Species Pres. Purity   Source  

SPINK13 overexpression lysate

SPINK13 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn