NBP1-69198 SPINT2 antibody

See related secondary antibodies

Search for all "SPINT2"

50 µg / €390.00

Quick Overview

Rabbit anti Human SPINT2


Product Description for SPINT2

Rabbit anti Human SPINT2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SPINT2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ45571, HAI-2, HAI2, Kop, PB
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SPINT2 (serine peptidase inhibitor, Kunitz type, 2) The peptide sequence was selected from the middle region of SPINT2. Peptide sequence RWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK.
Background HAI-2 (SPINT2) is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the KD-1 domain of HAI-2 is the key region responsible for its anti-invasive function. It is also implicated in human cervical cancer.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn