discontinued

H00007536-M01 Splicing factor 1 (SF1) antibody

See related secondary antibodies

Search for all "Splicing factor 1 (SF1)"

Quick Overview

Mouse anti Human Splicing factor 1 (SF1) 2E12

H00007536-M01

More Views

  • H00007536-M01
  • H00007536-M01

Product Description for Splicing factor 1 (SF1)

Mouse anti Human Splicing factor 1 (SF1) 2E12.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot, Paraffin Sections.

Properties for Splicing factor 1 (SF1)

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms BBP, Mammalian branch point-binding protein, Transcription factor ZFM1, ZFM1, ZNF162, Zinc finger gene in MEN1 locus, Zinc finger protein 162
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, P, WB
Clonality Monoclonal
Clone 2E12
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15637
Immunogen:
SF1 (NP_004621, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNP EDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERH*
GeneID:
7536
Remarks:
Gene Accession: NM_004630
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant SF1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,IHC-P,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7536

Accessory Products

Proteins and/or Positive Controls

Proteins for Splicing factor 1 (SF1) (6 products)

Catalog No. Species Pres. Purity   Source  

Splicing factor 1 (SF1) (transcript variant 3)

Splicing factor 1 (SF1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Splicing factor 1 (SF1)

Splicing factor 1 (SF1) Human
  Abnova Taiwan Corp.

Splicing factor 1 (SF1)

Splicing factor 1 (SF1) Human in vitro transl.
  Abnova Taiwan Corp.

Splicing factor 1 (SF1)

Splicing factor 1 (SF1) Human in vitro transl.
  Abnova Taiwan Corp.

Splicing factor 1 (SF1)

Splicing factor 1 (SF1) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Splicing factor 1 (SF1)

Splicing factor 1 (SF1) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Splicing factor 1 (SF1) (1 products)

Catalog No. Species Pres. Purity   Source  

SF1 Lysate

Western Blot: SF1 Lysate [NBL1-15873] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SF1
  Novus Biologicals Inc.
  • LinkedIn