TA333965 Splicing factor 1 (SF1) antibody

Rabbit Polyclonal Anti-SF1 Antibody

See related secondary antibodies

Search for all "Splicing factor 1 (SF1)"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Splicing factor 1 (SF1)

Product Description for Splicing factor 1 (SF1)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Splicing factor 1 (SF1).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Splicing factor 1 (SF1)

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BBP, Mammalian branch point-binding protein, Transcription factor ZFM1, ZFM1, ZNF162, Zinc finger gene in MEN1 locus, Zinc finger protein 162
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-SF1 Antibody: synthetic peptide directed towards the middle region of human SF1. Synthetic peptide located within the following region: VKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRP.
Application WB
Background SF1 contains 1 CCHC-type zinc finger and 1 KH domain. SF1 is Necessary for the ATP-dependent first step of spliceosome assembly. It binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mR. SF1 may act as transcription repressor.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Splicing factor 1 (SF1) (6 products)

Catalog No. Species Pres. Purity   Source  

Splicing factor 1 (SF1) (transcript variant 3)

Splicing factor 1 (SF1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Splicing factor 1 (SF1)

Splicing factor 1 (SF1) Human
  Abnova Taiwan Corp.

Splicing factor 1 (SF1)

Splicing factor 1 (SF1) Human in vitro transl.
  Abnova Taiwan Corp.

Splicing factor 1 (SF1)

Splicing factor 1 (SF1) Human in vitro transl.
  Abnova Taiwan Corp.

Splicing factor 1 (SF1)

Splicing factor 1 (SF1) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Splicing factor 1 (SF1)

Splicing factor 1 (SF1) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Splicing factor 1 (SF1) (1 products)

Catalog No. Species Pres. Purity   Source  

SF1 Lysate

Western Blot: SF1 Lysate [NBL1-15873] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SF1
  Novus Biologicals Inc.
  • LinkedIn