discontinued

NBP1-59686 SPOCK3 antibody

See related secondary antibodies

Search for all "SPOCK3"

Quick Overview

Rabbit anti Human, Mouse SPOCK3

Product Description for SPOCK3

Rabbit anti Human, Mouse SPOCK3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SPOCK3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms HSAJ1454, TES-3
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B3KR67
Immunogen:
Synthetic peptides corresponding to SPOCK3(sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3) The peptide sequence was selected from the middle region of SPOCK3. Peptide sequence CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKA
GeneID:
50859
Background Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 is a member of a novel Ca(2+)-binding proteoglycan familyProteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 encodes a member of a novel Ca(2+)-binding proteoglycan family.[supplied by OMIM].
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 50859

Accessory Products

  • LinkedIn