TA340177 Spondin 2 / SPON2 antibody

Rabbit Polyclonal Anti-SPON2 Antibody

See related secondary antibodies

Search for all "Spondin 2 / SPON2"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish Spondin 2 / SPON2

Product Description for Spondin 2 / SPON2

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish Spondin 2 / SPON2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Spondin 2 / SPON2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DIL-1, DIL1, Differentially expressed in cancerous and non-cancerous lung cells 1, M-spondin, Mindin, Spondin-2
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BUD6
Immunogen:
The immunogen for anti-SPON2 antibody: synthetic peptide directed towards the N terminal of human SPON2. Synthetic peptide located within the following region: CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW.
GeneID:
10417
Application WB
Background SPON2 is a cell adhesion protein that promote adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. It is essential in the initiation of the inte immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Spondin 2 / SPON2 (3 products)

Catalog No. Species Pres. Purity   Source  

Spondin 2 / SPON2

Spondin 2 / SPON2 Human
  Abnova Taiwan Corp.

Spondin 2 / SPON2

Spondin 2 / SPON2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Spondin 2 / SPON2

Spondin 2 / SPON2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Spondin 2 / SPON2 (4 products)

Catalog No. Species Pres. Purity   Source  

SPON2 293T Cell Transient Overexpression Lysate(Denatured)

SPON2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SPON2 overexpression lysate

SPON2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

SPON2 overexpression lysate

SPON2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

Spondin-2 Lysate

Western Blot: Spondin-2 Lysate [NBL1-16418] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SPON2
  Novus Biologicals Inc.
  • LinkedIn