
NBP1-57070 SPPL3 antibody

See related secondary antibodies

Search for all "SPPL3"

Quick Overview

Rabbit anti Human SPPL3


Product Description for SPPL3

Rabbit anti Human SPPL3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SPPL3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms IMP2
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to UNQ1887 (signal peptide peptidase 3) The peptide sequence was selected from the middle region of UNQ1887. Peptide sequence VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF.
Background UNQ1887 may act as intramembrane protease.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 121665

Accessory Products

  • LinkedIn