discontinued

NBP1-56591 SSBP3 antibody

See related secondary antibodies

Search for all "SSBP3"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Rat SSBP3

Product Description for SSBP3

Rabbit anti Human, Mouse, Rat SSBP3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SSBP3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CSDP, FLJ10355, SSDP, SSDP1
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T860
Immunogen:
Synthetic peptides corresponding to SSBP3(single stranded DNA binding protein 3) The peptide sequence was selected from the middle region of SSBP3. Peptide sequence DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV.
GeneID:
23648
Background SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 23648

Accessory Products

  • LinkedIn