NBP1-56649 ST14 antibody

See related secondary antibodies

Search for all "ST14"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rabbit, Rat, Xenopus ST14

More Views

  • NBP1-56649

Product Description for ST14

Rabbit anti Bovine, Human, Mouse, Rabbit, Rat, Xenopus ST14.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ST14

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Bov, Hu, Ms, Rb, Rt, Xen
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ST14(suppression of tumorigenicity 14 (colon carcinoma)) The peptide sequence was selected from the C terminal of ST14. Peptide sequence SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT.
Background ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn