discontinued

NBP1-62481 ST3GAL4 antibody

See related secondary antibodies

Search for all "ST3GAL4"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Rat ST3GAL4

Product Description for ST3GAL4

Rabbit anti Human, Mouse, Rat ST3GAL4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ST3GAL4

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6IBE6
Immunogen:
Synthetic peptides corresponding to ST3GAL4(ST3 beta-galactoside alpha-2,3-sialyltransferase 4) The peptide sequence was selected from the middle region of ST3GAL4. Peptide sequence IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM.
GeneID:
6484
Background It may catalyze the formation of the NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc-sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. It may be involved in the biosynthesis of the sialyl Lewis X determinant.Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase (EC 2.4.99.1), ST6GAL1 (MIM 109675) (Chang et al., 1995 [PubMed 7655169]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 6484

Accessory Products

  • LinkedIn