discontinued

NBP1-74154 ST6GAL2 antibody

See related secondary antibodies

Search for all "ST6GAL2"

50 µg / €440.00

Quick Overview

Rabbit anti Mouse ST6GAL2

NBP1-74154

Product Description for ST6GAL2

Rabbit anti Mouse ST6GAL2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ST6GAL2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B2RQY9
Immunogen:
Synthetic peptides corresponding to the C terminal of St6gal2. Immunizing peptide sequence RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT.
GeneID:
240119
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
State:
Aff - Purified
Gene ID 240119

Accessory Products

  • LinkedIn