
NBP1-59818 STEP antibody

See related secondary antibodies

Search for all "STEP"

Quick Overview

Rabbit anti Human, Mouse, Rat STEP

Product Description for STEP

Rabbit anti Human, Mouse, Rat STEP.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for STEP

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ14427, PTPSTEP, STEP
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PTPN5(protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)) The peptide sequence was selected from the middle region of PTPN5. Peptide sequence VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLD
Background The specific functin of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 84867

Accessory Products

  • LinkedIn