
NBP1-55214 Sterol carrier protein 2 antibody

See related secondary antibodies

Search for all "Sterol carrier protein 2"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Rat Sterol carrier protein 2

Product Description for Sterol carrier protein 2

Rabbit anti Human, Mouse, Rat Sterol carrier protein 2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Sterol carrier protein 2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp686C12188, DKFZp686D11188, NLTP, NSL-TP, SCPX
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SCP2(sterol carrier protein 2) The peptide sequence was selected from the middle region of SCP2. Peptide sequence NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA.
Background SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 6342

Accessory Products

  • LinkedIn