
NBP1-69059 STK25 antibody

See related secondary antibodies

Search for all "STK25"

Quick Overview

Rabbit anti Rat STK25


Product Description for STK25

Rabbit anti Rat STK25.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for STK25

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to Stk25 (serine/threonine kinase 25 (STE20 homolog, yeast)) The peptide sequence was selected from the C terminal of Stk25. Peptide sequence TKKTSFLTELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPP.
Background The function of Stk25 remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 373542

Accessory Products

  • LinkedIn