TA329655 SUPT3H / SPT3 antibody

Rabbit Polyclonal anti-SUPT3H antibody

See related secondary antibodies

Search for all "SUPT3H / SPT3"

0.1 mg / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SUPT3H / SPT3


More Views

  • TA329655

Product Description for SUPT3H / SPT3

Rabbit anti Human SUPT3H / SPT3.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SUPT3H / SPT3

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms SPT3-like protein, SPT3L, Transcription initiation protein SPT3 homolog
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-SUPT3H antibody: synthetic peptide directed towards the N terminal of human SUPT3H. Synthetic peptide located within the following region: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI.
Application WB
Background SUPT3H is a component of the multiprotein SPT-ADA-GCN5 acetyltransferase (SAGA) complex that integrates proteins with transcription coactivator/adaptor functions (ADAs and GCN5), histone acetyltransferase activity (GCN5), and core promoter-selective functions (SPTs) involving interactions with the TATA-binding protein (TBP).
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for SUPT3H / SPT3 (3 products)

Catalog No. Species Pres. Purity   Source  

SUPT3H / SPT3 (full length, N-term HIS tag, transcript variant 2)

SUPT3H / SPT3 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli

Regular Price: 50 µg / €199.00

Special Price: 50 µg / €205.00

  OriGene Technologies, Inc.


SUPT3H / SPT3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


SUPT3H / SPT3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SUPT3H / SPT3 (2 products)

Catalog No. Species Pres. Purity   Source  

SPT3 Lysate

Western Blot: SPT3 Lysate [NBL1-16616] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SUPT3H
  Novus Biologicals Inc.

SUPT3H overexpression lysate

SUPT3H overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn