NBP1-90561 SVIP antibody

See related secondary antibodies

Search for all "SVIP"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SVIP

Product Description for SVIP

Rabbit anti Human SVIP.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for SVIP

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NHG7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS
GeneID:
258010
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 258010

Accessory Products

Proteins and/or Positive Controls

Proteins for SVIP (2 products)

Catalog No. Species Pres. Purity   Source  

SVIP (1-77, His-tag)

SVIP Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €940.00
  Acris Antibodies GmbH

SVIP (1-77, His-tag)

SVIP Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €370.00
  Acris Antibodies GmbH
  • LinkedIn