discontinued

NBP1-90561 SVIP antibody

See related secondary antibodies

Search for all "SVIP"

Quick Overview

Rabbit anti Human SVIP

Product Description for SVIP

Rabbit anti Human SVIP.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for SVIP

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NHG7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS
GeneID:
258010
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 258010

Accessory Products

Proteins and/or Positive Controls

Proteins for SVIP (2 products)

Catalog No. Species Pres. Purity   Source  

SVIP (1-77, His-tag)

SVIP Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €940.00
  Acris Antibodies GmbH

SVIP (1-77, His-tag)

SVIP Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €370.00
  Acris Antibodies GmbH
  • LinkedIn