NBP1-69132 TAAR5 antibody

See related secondary antibodies

Search for all "TAAR5"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TAAR5

NBP1-69132

Product Description for TAAR5

Rabbit anti Human TAAR5.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for TAAR5

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC138414, MGC138416, PNR, RP11-295F4.5
Presentation Aff - Purified
Reactivity Hu
Applications ICC/IF, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5QD28
Immunogen:
Synthetic peptides corresponding to TAAR5 (trace amine associated receptor 5) The peptide sequence was selected from the middle region of TAAR5. Peptide sequence GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA.
GeneID:
472128
Background TAAR5 is an orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 472128

Accessory Products

  • LinkedIn