discontinued

NBP1-58845 TAB1 antibody

See related secondary antibodies

Search for all "TAB1"

50 µg / €390.00

Quick Overview

Rabbit anti Human, Mouse, Rat TAB1

Product Description for TAB1

Rabbit anti Human, Mouse, Rat TAB1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TAB1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IZW2
Immunogen:
Synthetic peptides corresponding to MAP3K7IP1(mitogen-activated protein kinase kinase kinase 7 interacting protein 1) The peptide sequence was selected from the N terminal of MAP3K7IP1. Peptide sequence MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRS
GeneID:
10454
Background The specific function of the protein remains unknown.The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 10454

Accessory Products

  • LinkedIn