H00079101-B01P TAF1D antibody

See related secondary antibodies

Search for all "TAF1D"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TAF1D

H00079101-B01P

Product Description for TAF1D

Mouse anti Human TAF1D.
Product is tested for Western blot / Immunoblot.

Properties for TAF1D

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms JOSD3, MGC5306, TAF(I)41
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H5J8
Immunogen:
TAF1D (NP_077021.1, 1 a.a. ~ 278 a.a) full-length human protein.
AA Sequence:
MDKSGIDSLDHVTSDAVELANRSDNSSDSSLFKTQCIPYSPKGEKRNPIRKFVRTPESVHASDSSSDSSFEPIPLT IKAIFERFKNRKKRYKKKKKRRYQPTGRPRGRPEGRRNPIYSLIDKKKQFRSRGSGFPFLESENEKNAPWRKILTF EQAVARGFFNYIEKLKYEHHLKESLKQMNVGEDLENEDFDSRRYKFLDDDGSISPIEESTAEDEDATHLEDNECDI KLAGDSFIVSSEFPVRLSVYLEEEDITEEAALSKKRATKAKNTGQRGLKM
GeneID:
79101
Add. information Mouse polyclonal antibody raised against a full-length human TAF1D protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for TAF1D (1 products)

Catalog No. Species Pres. Purity   Source  

TAF1D Lysate

Western Blot: TAF1D Lysate [NBL1-12110] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TAF1D
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn