discontinued

H00010629-D01 TAF6L antibody

See related secondary antibodies

Search for all "TAF6L"

Quick Overview

Rabbit anti Human TAF6L

Product Description for TAF6L

Rabbit anti Human TAF6L.
Presentation: Serum
Product is tested for ELISA (detection), Immunoprecipitation.

Properties for TAF6L

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms PAF65-alpha, PAF65A, PCAF-associated factor 65 alpha, TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L
Presentation Serum
Reactivity Hu
Applications E(detection), IP
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y6J9
Immunogen:
TAF6L (AAH08785.1, 1 a.a. ~ 459 a.a) full-length human protein.
AA Sequence:
MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQNSSQFMKHTKRRKLTVEDFNRALRWSS VEAVCGYGSQEALPMRPAREGELYFPEDREVNLVELALATNIPKGCAETAVRVHVSYLDGKGNLAPQGSVPSAVSS LTDDLLKYYHQVTRAVLGDDPQLMKVALQDLQTNSKIGALLPYFVYVVSGVKSVSHDLEQLHRLLQVARSLFRNPH LCLGPYVRCLVGSVLYCVLEPLAASINPLNDHWTLRDGAALLLSHIFWTHGDLVSGLYQHILLSLQKILADPVRPL CCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPN RGGPGGRGCRRLDDLPWDSLLFQESSSGGGAEPSFGSGLPLPPGGAGPEDPSLSVTLADIYRELYAFFGDSLATRF GTG
GeneID:
10629
Remarks:
Gene Accession: BC008785.2
Add. information Rabbit polyclonal antibody raised against a full-length human TAF6L protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IP
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 10629

Accessory Products

Proteins and/or Positive Controls

Proteins for TAF6L (4 products)

Catalog No. Species Pres. Purity   Source  

TAF6L

TAF6L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TAF6L

TAF6L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TAF6L

TAF6L Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TAF6L

TAF6L Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TAF6L (1 products)

Catalog No. Species Pres. Purity   Source  

TAF6L 293T Cell Transient Overexpression Lysate(Denatured)

TAF6L 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn