NBP1-74133 TAF6L antibody

See related secondary antibodies

Search for all "TAF6L"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Rat TAF6L

NBP1-74133

Product Description for TAF6L

Rabbit anti Rat TAF6L.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TAF6L

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B5DF37
Immunogen:
Synthetic peptides corresponding to the middle region of Taf6l. Immunizing peptide sequence PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS.
GeneID:
309194
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
State:
Aff - Purified
Gene ID 309194

Accessory Products

  • LinkedIn