
NBP1-74133 TAF6L antibody

See related secondary antibodies

Search for all "TAF6L"

50 µg / €440.00

Quick Overview

Rabbit anti Rat TAF6L


Product Description for TAF6L

Rabbit anti Rat TAF6L.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TAF6L

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the middle region of Taf6l. Immunizing peptide sequence PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS.
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified
Gene ID 309194

Accessory Products

  • LinkedIn