TA329954 TAF7L antibody

Rabbit Polyclonal Anti-Taf7l Antibody

See related secondary antibodies

Search for all "TAF7L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse TAF7L

Product Description for TAF7L

Rabbit anti Mouse TAF7L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TAF7L

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms CT40, Cancer/testis antigen 40, RNA polymerase II TBP-associated factor subunit Q, TAF2Q, TATA box-binding protein-associated factor 50 kDa, Transcription initiation factor TFIID 50 kDa subunit, Transcription initiation factor TFIID subunit 7-like
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-Taf7l antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Taf7l. Synthetic peptide located within the following region: QMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQ.
Application WB
Background Taf7l probably functions as a spermatogensis-specific component of the D-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. It may play a role in spermatogenesis.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn