TA329955 TAF7L antibody

Rabbit Polyclonal Anti-TAF7L Antibody

See related secondary antibodies

Search for all "TAF7L"

0.1 mg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse TAF7L

Product Description for TAF7L

Rabbit anti Mouse TAF7L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TAF7L

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CT40, Cancer/testis antigen 40, RNA polymerase II TBP-associated factor subunit Q, TAF2Q, TATA box-binding protein-associated factor 50 kDa, Transcription initiation factor TFIID 50 kDa subunit, Transcription initiation factor TFIID subunit 7-like
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TAF7L antibody: synthetic peptide directed towards the middle region of mouse TAF7L. Synthetic peptide located within the following region: DEDYGNEKEEEETDNSEEELEKELQAKFNEFSLHEADQDYSSITMAIQKL.
Application WB
Background TAF7I belongs to the family of TATA box binding protein (Tbp)-associated factors. Promoter selectivity for all three classes of eukaryotic R polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs).
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn